A practical reference on freeze-thaw cycle: what it is, how it behaves, what the literature reports, and where the honest uncertainties sit.
Reviewed 2025-12-22. Anything still debated is marked as such rather than presented as settled.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
Reported observations after unregulated use include shifts in skin pigmentation and, in some accounts, unintended changes to moles and other lesions. Whether these outcomes are causally linked to the compound, and how often they occur, remain open questions because controlled data are scarce. The absence of standardised dosing and verified product purity complicates interpretation. Researchers have called for better surveillance and analytical characterisation of samples obtained outside regulated channels. Conclusions drawn from anecdotal evidence should be treated as provisional.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, the naturally occurring peptide involved in pigmentation signalling. Its sequence is conventionally written as Ac-Nle-cyclo[Asp-His-D-Phe-Arg-Trp-Lys]-NH2, with a lactam bridge joining the aspartate side chain to the lysine side chain. The empirical formula is C50H69N15O9 and the monoisotopic mass lies near 1023.5 daltons. N-terminal acetylation and the D-configured phenylalanine both increase resistance to enzymatic breakdown compared with the parent hormone.
Pharmacologically, melanotan-2 behaves as a non-selective agonist across the melanocortin receptor family. Binding at MC1R on dermal melanocytes promotes eumelanin synthesis, which underlies the tanning response described in early human work. Activity at the centrally expressed MC4R receptor is associated with reported effects on appetite and erectile function. Because the peptide does not discriminate strongly among receptor subtypes, attributing any single observed effect to one receptor pathway is generally not possible without selective antagonists or receptor knockout models.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Unapproved for therapeutic use | No marketing authorisation from major agencies |
| Legal classification | Varies by jurisdiction | Prescription-only or controlled in several countries |
| Common synonyms | Melanotan II; MT-II | Also referenced by catalogue codes |
| Typical analytical method | Reverse-phase HPLC | Often paired with mass spectrometry |
| Primary literature focus | Receptor pharmacology | Pigmentation and melanocortin signalling |
Solid peptide kept dry at minus twenty degrees Celsius, shielded from light and moisture, is generally considered stable for extended periods. Solutions are divided into single-use aliquots and held at minus twenty or minus eighty degrees Celsius, because repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. Hydrolysis of the backbone and oxidation of tryptophan are the principal degradation routes in aqueous solution, and both accelerate at ambient temperature. Hygroscopic uptake after a vial is opened can also shift the actual mass weighed, which affects any concentration calculated from it.
Routine characterisation relies on reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, using a C18 column and a water-acetonitrile gradient containing trifluoroacetic acid. Electrospray ionisation mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidised by-products that co-elute poorly. Sequence and stereochemistry require additional work, such as peptide mapping or amino acid analysis, because a chromatographic purity figure alone does not distinguish a diastereomer from the target peptide. Independent testing of research-grade material frequently shows measured content below the stated label, so a certificate of analysis is best read together with the method that produced it.
Melanotan-2 is handled in the laboratory as a lyophilised powder that dissolves readily in water, dimethyl sulfoxide and dimethylformamide, with limited solubility in ethanol. Stock solutions prepared in an organic solvent often precipitate when diluted into aqueous buffer, so gradual dilution with mixing is standard practice. The peptide carries a tryptophan residue and a histidine residue, both sensitive to oxidation and to alkaline conditions. Working solutions are therefore kept near neutral to slightly acidic pH, protected from light, and consumed within the same working session whenever that is practical.
Melanotan II is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its structure substitutes a lactam bridge between side chains to increase stability relative to the native hormone. The compound is also known by the shorthand MT-II and by several non-proprietary synonyms used in research catalogues. It is not an approved therapeutic product in any major jurisdiction; material sold under this name is typically offered as a laboratory reagent rather than as a medicine.
Activity is attributed to agonism at melanocortin receptors, particularly MC1R and MC4R. Activation of MC1R on melanocytes increases melanin synthesis, which underlies the reported tanning effect. MC4R engagement in the central nervous system is linked to appetite suppression and to effects on sexual arousal reported in early clinical studies. Those studies were small and were not designed to establish efficacy or long-term safety. Receptor selectivity among the melanocortin subtypes is not absolute, which complicates attribution of any effect to a single pathway.
Regulatory treatment varies between countries. Several national medicines agencies have classified the peptide as unapproved, and customs authorities in some jurisdictions seize shipments on that basis. A few jurisdictions channel supply through prescription-only frameworks that do not list the substance by name. Because the material circulates mainly through online vendors, composition and purity are rarely verified before sale. Surveys of unapproved peptide products have reported labels that did not match measured content in a substantial fraction of samples.
Identity and purity are usually assessed by reversed-phase high-performance liquid chromatography, which separates the target peptide from truncated or oxidised impurities. Mass spectrometry, most often coupled to liquid chromatography, confirms molecular mass and detects substitutions that chromatography alone may miss. Amino acid analysis and peptide mapping supply additional structural evidence, while nuclear magnetic resonance is reserved for full structural confirmation. Laboratories that examine samples sold online report wide variation in actual content, with some vials containing little or none of the labelled material.
Melanotan-2 appears on the World Anti-Doping Agency prohibited list within the peptide hormone class, and several national regulators treat it as an unapproved prescription substance. Some countries restrict importation or sale for personal use. Because the compound is widely traded as a research chemical, the practical legal picture differs between jurisdictions and shifts over time. Human safety data covering long periods are limited, and whether repeated pigmentation changes carry any lasting risk to melanocytes remains an open question.
Freeze-dried melanotan-2 is normally kept as a desiccated powder at minus twenty degrees Celsius or lower, shielded from light and moisture. Peptides of this size degrade through hydrolysis, oxidation and deamidation, and each pathway accelerates as temperature and water activity rise. Repeated freeze-thaw cycles promote aggregation and loss of material, so aliquoting a stock solution before freezing is standard laboratory practice. Once dissolved, the solution is markedly less stable than the powder. In laboratory work, solutions are generally refrigerated and used within days rather than kept for months.
==== Yogācāra ==== The yogācāra school interpreted the doctrine of dependent origination through its central schema of the "three natures" (which are really three ways of looking at one dependently originated reality). In this schema, the constructed or fabricated nature is an illusory appearance (of a dualistic self), while the "dependent nature" refers specifically to the process of dependent origination or as Jonathan Gold puts it "the causal story that brings about this seeming self." Furthermore, as Gold notes, in Yogacara, "this causal story is entirely mental," and so our body, sense bases and so on are illusory appearances. Indeed, D.W. Mitchell writes that yogācāra sees consciousness as "the causal force" behind dependent arising. Dependent origination is therefore "the causal series according to which the mental seeds planted by previous deeds ripen into the appearance of the sense bases". This "stream of dependent mental processes" as Harvey describes it, is what generates the subject-object split (and thus the idea of a '"self" and "other" things which are not the self). The third nature then, is the fact that dependent origination is empty of a self, the fact that even though self (as well as an "other", that which is apart from the self) appears, it does not exist.
=== Anticancer therapeutics === Intracellular heat shock proteins are highly expressed in cancerous cells and are essential to the survival of these cell types due to presence of mutated and over-expressed oncogenes. Many HSPs can also promote invasiveness and metastasis formation in tumours, block apoptosis, or promote resistance to anti-cancer drugs. Hence small molecule inhibitors of HSPs, especially Hsp90 show promise as anticancer agents. The potent Hsp90 inhibitor 17-AAG was in clinical trials for the treatment of several types of cancer, but for various reasons unrelated to efficacy did not go on to Phase 3. HSPgp96 also shows promise as an anticancer treatment and is currently in clinical trials against non-small cell lung cancer.
=== Heroin epidemic === During the Nixon administration, the country faced a heroin epidemic. There were 15 times as many heroin addicts in Washington, D.C., as there were in all of England. The US government responded in two ways. The first response came from Nixon's newly appointed Special Action Office for Drug Abuse Prevention, headed by Jerome Jaffe to provide free synthetic alternatives to heroin in the form of government-regulated methadone. The idea was not to cure the addicts but to prevent them from engaging in street crimes to feed their addictions. The second response came in the form of an increased police presence. Some community activists criticized the Nixon treatment program, many of whom saw heroin addiction and methadone treatment as a new form of black oppression. There was a call from black community leaders for more punitive action against dealers and users. Black activists in Chicago, DC, and Harlem called on government to increase the policing and the sentencing for individuals involved in robbery, mugging, street dealing and murder. Many civil rights advocates pushed back against the law and order rhetoric that won Nixon the White House, but other activists from some of the most drug-affected cities were some of the earliest supporters of more punitive drug policies. Scholars argue that conservative politicians used the calls from the nation's urban leaders as proof that the law and order policies had nothing to do with race. Many historians, including Foreman Jr.
Sources: en.wikipedia.org
John Stewart is last seen wounded and bleeding, being taken to Henshaw by Boodikka. Cyborg Superman then begins the cosmetic surgery to turn John into another Alpha Lantern. Before starting the operation, however, Henshaw connects Stewart's brain to his memories to see why he was turned into a cyborg. He also reveals to John, that, after being resurrected by the Manhunters after the Sinestro Corps War, he returned to Earth in the middle of the "Blackest Night", and pleaded to the Black Lanterns (among them are the former crew of his space shuttle) and Nekron to kill him, only to discover that because he did not have a physical heart, he was invisible to them. Angered for being ignored by death itself, the Cyborg Superman encountered the mysterious hooded stranger who abducted the entities of the Emotional Spectrum. He convinced him that Ganthet has the power and knowledge to turn Alpha Lanterns into normal beings again. John realizes that Henshaw organized the revolt of the Alpha Lanterns with the sole purpose to attract Ganthet to the planet Grenda and forced him to turn Henshaw into a mortal being again. Kyle and Soranik burst into the lab and manage to rescue John, but Ganthet is captured. They hide in a cave, where John informs them about the Cyborg Superman's true plan. They also discover the missing robot inhabitants of the planet, trapped in the depths of the cave by Henshaw. Mounting a defense, they battle against Henshaw and his forces, destroying the cyborg's body.
15-Oxo-ETE). Other eicosanoid oxoreductases that use NAD+ and NADH as co-factors include: 12-hydroxyicosatetraenoate dehydrogenase which metabolizes 12-hydroxyeicosatetraenoic acid (12-HETE) and LTB4 to their corresponding 12-oxo analogs and 11-hydroxy-TXB2 dehydrogenase, which metabolizes TXB2 to its 11-oxo analog; and 15-hydroxyprostaglandin dehydrogenase (NAD+) which metabolizes (5Z,13E)-(15S)-11alpha,15-dihydroxy-9-oxoprost-13-enoate to its 15-oxo analog. Other eicosanoid oxireductases that use NADP+ and NADPH as cofactors include LTB4 12-hydroxy dehydrogenase which metabolizes LTB4 to its 12-oxo analog, and 15-hydroxyprostaglandin-D dehydrogenase (NADP+), 15-hydroxyprostaglandin-I dehydrogenase (NADP+), and 15-hydroxyprostaglandin dehydrogenase (NADP+) which metabolize PGD2, PGI2, and (13E)-(15S)-11alpha,15-dihydroxy-9-oxoprost-13-enoate, respectively, to their corresponding 15-oxo analogs.
The Streptavidin-Binding Peptide (SBP)-Tag is a 38-amino acid sequence that may be engineered into recombinant proteins. Recombinant proteins containing the SBP-Tag bind to streptavidin and this property may be utilized in specific purification, detection or immobilization strategies. The sequence of the SBP tag is MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP. The Streptavidin-Binding Peptide was discovered within a library of seven trillion stochastically generated peptides using the in vitro selection technique of mRNA Display. Selection was performed by incubating with streptavidin-agarose followed by elution with biotin. The SBP-Tag has been shown to bind streptavidin with an equilibrium dissociation constant of 2.5nM and is readily eluted with biotin under native conditions.
Escitalopram was developed in cooperation between Lundbeck and Forest Laboratories. Its development was initiated in 1997, and the resulting new drug application was submitted to the US FDA in March 2001. The short time (3.5 years) it took to develop escitalopram can be attributed to the previous experience of Lundbeck and Forest with citalopram, which has similar pharmacology.
Sources: en.wikipedia.org
2° being the center (Bolivia) weakened by the forces of both (Argentina and Peru)". The first indications of this policy for the domain of the South Pacific occurred in the Conquest of Chiloé. After the first Chilean attempt to annex the archipelago failed, Simón Bolívar (Peru's dictator at the time), eager to curry favor with the Peruvian elite, began to consider sending an expedition to bring it under the sovereignty of Lima, based on the uti possidetis iuris (because Chiloé was under the direct administration of the Viceroyalty of Peru, and then, to this republic corresponded the territory), before Spain negotiated and ceded the island potentially to the United Kingdom or France, powers that were known to be interested in that territory, or the Chilotas attempted an expedition to some region of the South Pacific. For the Chilean government, having Bolivarian troops to the south and north (in 1825, after the occupation of Upper Peru, the forces of Bolívar went on to seize all the territory north of the Loa) was considered a threat to their sovereignty. For the same reason, Bolívar's offer to form a joint expedition that would include 2,000 Colombian soldiers was rejected. Finally, the ruler of Colombia and Peru would demand that the Freire government end the threat that royalist Chiloé posed to South America or annex it to Peru (Bolivar was willing to renounce Peruvian claims to the territory to avoid strengthening Peru economically).
Libiguin A is a naturally occurring limonoid found in Neobeguea mahafalensis, a flowering plant found in Madagascar with a long history of traditional medical use. It is a derivative of phragmalin. The compound has been reported to produce highly potent, strong, and long-lasting pro-sexual effects in rodents. The semisynthesis of libiguin A from phragmalin has been described. An analogue also found in Neobeguea mahafalensis, libiguin B, has similar pro-sexual effects but is far less potent in comparison. Another analogue, a synthetic compound known as volufralin (LIB-01; DIC-2024), is under development for the treatment of erectile dysfunction and premature ejaculation. Libiguin A was first described in the scientific literature by 2014.
It was a formidable fighting force consisting of 1,487 tanks, 1,384 infantry fighting vehicles, 568 artillery pieces, 132 MLRS, 8 missile launchers, and 242 attack helicopters. It had a total troop strength of 146,321 troops. Its primary full strength fighting formations were the 1st Armored Division (United States), the 3rd Armored Division (United States) and the 1st Infantry Division (United States). The 2nd Armored Division (Forward) was assigned to the 1st Infantry Division as its third maneuver brigade. Its Task Force 1-41 Infantry would be the spearhead of VII Corps. In addition, the corps had the 2nd Cavalry Regiment (United States) to act as a scouting and screening force, and two further heavy divisions, the 1st Cavalry Division (United States) and the United Kingdom's 1st Armoured Division, as well as the U.S. 11th Aviation Group. VII Corps fought a number of large battles against Iraqi forces, with some of historic scope and size. Three of the battles at Norfolk, Medina Ridge, and 73 Easting are considered among the largest tank battles in history. By the end of combat operations on 28 February 1991, U.S. VII Corps had driven 260 kilometres (160 mi), captured 22,000 Iraqi soldiers, and destroyed 1,350 Iraqi tanks, 1,224 armored personnel carriers, 285 artillery pieces, 105 air defense systems, and 1,229 trucks.
Sources: en.wikipedia.org
Major regulatory agencies have not approved it for any indication. Some countries permit it only under prescription frameworks, while others classify it as a controlled substance.
Much of the evidence comes from case reports and accounts of unregulated use rather than controlled trials. Differences in product purity and dosing add further variability.
Laboratory work focuses on receptor binding and cellular signalling. Observational reports document outcomes after use, and analytical chemists examine samples to assess content and purity.
It is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, containing seven amino acids with a lactam ring and a D-configured phenylalanine residue. It is supplied as a lyophilised powder for laboratory research.