If you have been reading about lyophilised powder and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Updated 2026-05-03. Numbers and descriptions here follow the published literature rather than marketing material.
Melanocortin receptors comprise five subtypes with distinct tissue distributions and functions. Melanotan-2 is described in the literature as a non-selective agonist that engages several of these subtypes, including MC1R, MC3R, MC4R, and MC5R. MC1R is the subtype most directly linked to melanin production in skin cells. Because the compound is not subtype-selective, its observed effects in experimental settings are generally attributed to activity across multiple receptor pathways rather than to a single target.
Melanotan-2 is a synthetic linear peptide built from seven amino acids arranged in a short chain. Its sequence is commonly written as Ac-Nle-Asp-His-D-Phe-Arg-Trp-Lys-NH2, which includes a modified N-terminus and an amidated C-terminus. The molecule belongs to the melanocortin family and acts as a receptor agonist. Structural features such as the D-phenylalanine residue and the Nle substitution are associated with increased stability against enzymatic degradation relative to the natural parent peptide.
The compound emerged from research programs in the 1980s that examined analogues of alpha-melanocyte-stimulating hormone for pigmentation and photoprotection. Investigators modified the native sequence to extend activity duration and potency. A related analogue, afamelanotide, was developed within the same broad line of inquiry and eventually gained approval in certain jurisdictions for a rare light-sensitivity condition. Melanotan-2 itself did not progress through the same regulatory route and has no approved therapeutic indication.
Lyophilized peptide powder is generally stored frozen, protected from light and moisture. Tryptophan residues are susceptible to oxidation, and the lactam bridge can hydrolyze under strongly acidic or basic conditions. Solutions prepared for laboratory work degrade faster than dry powder, and repeated freeze-thaw cycles accelerate loss. Common practice is to aliquot solutions before freezing and to avoid alkaline buffers. Reported stability windows vary with concentration, buffer, and temperature, so exact shelf lives are method-specific rather than universal.
Regulatory status differs by country, and in many places supplying the compound for human consumption is unlawful. Vendors frequently label material as intended for research use only, a designation that shifts stated purpose but does not create a legal pathway for personal use. Certificates of analysis accompanying such products vary widely in detail and provenance. Third-party testing exists but is voluntary, and results are rarely linked to a specific lot in a publicly verifiable way.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C50H69N15O9 | Free base; salt forms differ |
| Molecular weight | Approximately 1024 g/mol | Calculated for the free base |
| Appearance | White to off-white powder | Typically supplied as a lyophilised solid |
| Solubility | Soluble in water and polar solvents | Poorly soluble in non-polar solvents |
| Typical storage | -20 degrees Celsius, dry, protected from light | Refers to the solid form |
Structurally, Melanotan-2 retains the core recognition motif of alpha-melanocyte-stimulating hormone while adding a lactam bridge that links two side chains and constrains the molecule into a ring. This modification lowers susceptibility to enzymatic degradation. The compound acts as an agonist at melanocortin receptors, particularly subtypes associated with melanin production. Because the same receptor family influences several physiological processes, researchers note that its activity is not confined to pigmentation alone. Receptor selectivity continues to be examined in published studies.
Melanotan-2 is a synthetic cyclic heptapeptide designed as an analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its sequence incorporates modified residues that increase potency and extend biological activity relative to the native hormone. The compound binds receptors of the melanocortin family and is examined mainly in laboratory research. It does not occur naturally and exists only as a manufactured chemical entity produced by solid-phase synthesis.
Solid peptide kept dry at minus twenty degrees Celsius, shielded from light and moisture, is generally considered stable for extended periods. Solutions are divided into single-use aliquots and held at minus twenty or minus eighty degrees Celsius, because repeated freeze-thaw cycles promote aggregation and loss of material to container surfaces. Hydrolysis of the backbone and oxidation of tryptophan are the principal degradation routes in aqueous solution, and both accelerate at ambient temperature. Hygroscopic uptake after a vial is opened can also shift the actual mass weighed, which affects any concentration calculated from it.
Routine characterisation relies on reversed-phase high-performance liquid chromatography with ultraviolet detection near 214 nanometres, using a C18 column and a water-acetonitrile gradient containing trifluoroacetic acid. Electrospray ionisation mass spectrometry confirms the expected molecular mass and can reveal truncated or oxidised by-products that co-elute poorly. Sequence and stereochemistry require additional work, such as peptide mapping or amino acid analysis, because a chromatographic purity figure alone does not distinguish a diastereomer from the target peptide. Independent testing of research-grade material frequently shows measured content below the stated label, so a certificate of analysis is best read together with the method that produced it.
Oral, intravenous, intra-arterial, or intramuscular routes of protein administration are not always as effective, as the therapeutic protein may be metabolized or cleared before it can enter the target tissue. Cell-based pro-angiogenic therapies are still early stages of research, with many open questions regarding best cell types and dosages to use.
== Creation of USAID and Decade of Development == At the end of the 1950s, the momentum in favor of development assistance – as represented by PL-480, new mechanisms for financial assistance, larger U.S. budgets and staffing, and multilateral initiatives – picked up support from Senator John F. Kennedy, who was preparing to be a candidate for the presidency. In 1957, JFK proposed, in bipartisan collaboration with Sen. John Sherman Cooper (a former U.S. Ambassador to India), a major expansion of U.S. economic support for India. As a candidate in 1960, he supported the emphasis on humanitarian goals for PL-480 set by Sen. Hubert Humphrey's "Food for Peace" Act of 1959 and supported the idea of a Peace Corps that was under development thanks to the initiatives of Sen. Humphrey, Rep. Reuss, and Sen. Neuberger. (See the "History" section of Peace Corps.) After his inauguration as president on January 20, 1961, JFK created the Peace Corps by Executive Order on March 1, 1961. On March 22, he sent a special message to Congress on foreign aid, asserting that the 1960s should be a "Decade of Development" and proposing to unify U.S. development assistance administration into a single agency. He sent a proposed "Act for International Development" to Congress in May and the resulting "Foreign Assistance Act" was approved in September, repealing the Mutual Security Act.
==== Summary ==== While clear benefits of using magnetic beads include the increased reaction speed, more gentle sample handling and the potential for automation, the choice of using agarose or magnetic beads based on the binding capacity of the support medium and the cost of the product may depend on the protein of interest and the IP method used. As with all assays, empirical testing is required to determine which method is optimal for a given application.
creatine Thus, the two substrates of this enzyme are creatinine and H2O, whereas its product is creatine. Creatininase is a member of the urease-related amidohydrolases, the family of hydrolases, those acting on carbon-nitrogen bonds other than peptide bonds, specifically in cyclic amides. The systematic name of this enzyme class is creatinine amidohydrolase. This enzyme is also called creatinine hydrolase. This enzyme participates in arginine and proline metabolism.
Sources: en.wikipedia.org
== Physiological potential == In a pre-clinical meta-analysis of gingerol compounds anticancer, anti-inflammatory, anti-fungal, antioxidant, neuroprotective and gastroprotective properties were reported, which include studies in-vitro and in-vivo. A few in-vivo studies have proposed that gingerols facilitate healthy glucose regulation for diabetics. Many studies have been around the effects of gingerols on a wide range of cancers including leukemia, prostate, breast, skin, ovarian, lung, pancreatic and colorectal. There has not been much clinical testing to observe gingerols physiological impacts in humans. While many of the chemical mechanisms associated with the effects of gingerols on cells have been thoroughly studied, few have been in a clinical setting. This is due to the high variability in natural phytochemicals and the lack of efficacy in research. Most herbal medicine, which include gingerols, are under the restrictions of the Food and Drug Administration in the United States and experimental methods have not held up to scrutiny which has decreased the value in phytochemical research. Herbal medicine is untested for quality assurance, potency and effectiveness in clinical settings due to a lack of funding in eastern medical research. Most research on [6]-Gingerol has been on either mouse subjects (in-vivo) or on cultured human tissue (in-vitro) and may be used in the future to discuss possible applications for multi-target disease control.
Zacarias Moussaoui who was indicted in December 2001 and sentenced to life in prison without the possibility of parole in May 2006 by a U.S. federal jury Mounir el-Motassadeq who was first convicted in February 2003 by a Federal Court of Justice in Germany and was deported to Morocco in October 2018 after serving his sentence Abu Dahdah who was arrested in November 2001, sentenced by a Spanish High Court and released from prison in May 2013. In July 2024, The New York Times reported that Mohammed, bin Attash, and al-Hawsawi had agreed to plead guilty to conspiracy in exchange for life sentences, avoiding trial and execution. However, U.S. Defense Secretary Lloyd Austin revoked a plea agreement with Mohammed days later.
==== Other types of T-cell help ==== The type of T-cell help raised is influenced by the delivery method and the type of immunogen expressed, as well as the targeting of different lymphoid compartments. Generally, saline needle injections (either IM or ID) tend to induce TH1 responses, while gene gun delivery raises TH2 responses. This is true for intracellular and plasma membrane-bound antigens, but not for secreted antigens, which seem to generate TH2 responses, regardless of the method of delivery. Generally the type of T-cell help raised is stable over time, and does not change when challenged or after subsequent immunizations that would normally have raised the opposite type of response in a naïve specimen. However, Mor et al.. (1995) immunized and boosted mice with pDNA encoding the circumsporozoite protein of the mouse malarial parasite Plasmodium yoelii (PyCSP) and found that the initial TH2 response changed, after boosting, to a TH1 response.
=== Mechanical properties === Not only does the material have to be biocompatible and conducive to proliferation, it also has to have mechanical properties similar to that of real skin in order to serve as an adequate substitute. Skin is the first line of defense for the body, so it is subject to lots of chemical and mechanical assaults. As such, the artificial skin needs to be strong and tear resistant from stretching that occurs in everyday activity. It also needs to be strong enough to resist sutures from surgery. Stiffness can be controlled in several ways. As previously mentioned, crosslinking through chemical or biophysical methods. Chemical methods produce stronger materials, but biophysical methods are more conducive to cell proliferation. Furthermore, it has been noted that skin is viscoelastic and undergoes hysteresis- it has a time dependent stress relaxation factor and goes through a separate path during unloading. Another important consideration is the wettability of the material. This is the ability of a liquid to maintain contact with a solid surface. If the CG matrix membrane does not wet the woundbed substrate properly, air pockets can form which will lead to infection. The membrane must not be too stiff so it can drape over the surface. Furthermore, shear (lateral) or peeling (normal) forces can displace the membrane such that air pockets can reform. This can be mitigated by adding an adhesive bond like eschar or scab between the two surfaces.
=== Off-label drugs === Anticonvulsants (e.g., valproic acid) Atypical antipsychotics (e.g., quetiapine) Azapirones (serotonin 5-HT1A receptor agonists) (e.g., buspirone) Benzodiazepines (GABAA receptor positive allosteric modulators) (e.g., alprazolam, chlordiazepoxide, clonazepam, diazepam, lorazepam) Beta blockers (e.g., propranolol) Gabapentinoids (α2δ subunit-containing voltage-gated calcium channel ligands) (e.g., gabapentin, pregabalin) Monoamine oxidase inhibitors (MAOIs) (e.g., isocarboxazid, moclobemide, phenelzine, tranylcypromine) NMDA receptor antagonists (e.g., ketamine, esketamine) Selective serotonin reuptake inhibitors (SSRIs) (e.g., citalopram, fluvoxamine) Serotonin–norepinephrine reuptake inhibitors (SNRIs) (e.g., desvenlafaxine, duloxetine, levomilnacipran, milnacipran) Serotonin modulators and stimulators (SMSs) (e.g., vilazodone, vortioxetine) Tricyclic antidepressants (TCAs) (e.g., amitriptyline, clomipramine, doxepin, imipramine) Tetracyclic antidepressants (TeCAs) (e.g., mirtazapine) Others (e.g., hydroxyzine)
Sources: en.wikipedia.org
=== Tuberous sclerosis complex === Sirolimus also shows promise in treating tuberous sclerosis complex (TSC), a congenital disorder that predisposes those afflicted to benign tumor growth in the brain, heart, kidneys, skin, and other organs. After several studies conclusively linked mTOR inhibitors to remission in TSC tumors, specifically subependymal giant-cell astrocytomas in children and angiomyolipomas in adults, many US doctors began prescribing sirolimus (Wyeth's Rapamune) and everolimus (Novartis's RAD001) to TSC patients off-label. Numerous clinical trials using both rapamycin analogs, involving both children and adults with TSC, are underway in the United States.
== Cultivation == The plants are propagated by cuttings about 40 to 50 cm (16 to 20 in) long, usually cultivars selected both for yield and quality of fruit. These are tied up to neighbouring trees or climbing frames at distances of about 2 m (6+1⁄2 ft) apart; trees with rough bark are favoured over those with smooth bark, as the pepper plants climb rough bark more readily. Competing plants are cleared away, leaving only sufficient trees to provide shade and permit free ventilation. The roots are covered in leaf mulch and manure, and the shoots are trimmed twice a year. On dry soils, the young plants require watering every other day during the dry season for the first three years. The plants bear fruit from the fourth or fifth year, and then typically for seven years. Harvesting begins as soon as one or two fruits at the base of the spikes begin to turn red, and before the fruit is fully mature, and still hard; if allowed to ripen completely, the fruits lose pungency, and ultimately fall off and are lost. The spikes are collected and spread out to dry in the sun, then the peppercorns are stripped off the spikes.
== Investigation == It was found that the only nurse who had cared for all five of the patients and had been there within 2 hours of them becoming catastrophically ill was Norris. Norris had been one of the few who was on duty at the time of Hall's deterioration in health. Police analysed medical staff rotas, phone records and personnel files to determine who had access to the wards, insulin and who was on the wards at the time of that incident, and it was found that all staff members except Norris could be ruled out as it was only Norris who was on duty when all the incidents occurred. He was also the only staff member who worked on both the wards where the incidents occurred. Norris admitted predicting the time of Hall's death to his colleague but said it was because he had a "black sense of humour". Investigators ordered the exhumation of the body of Bridget Bourke, which, significantly, revealed that she had been given large amounts of insulin. The other two patients who had died had their bodies cremated, so could not be tested. Norris was suspended from his job (on full pay) while the police investigation was carried out. After he was first arrested, Norris immediately left Leeds and went back to Scotland, before then leaving the UK eight times to go abroad, including to Tenerife for a six-month holiday. After his conviction his partner recounted an incident around this time when Norris became violent and drunk, and wouldn't stop crying because he said he was scared of going to prison.
In humans, EGF has 53 amino acids (sequence NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCzYRDLKWWELR), with a molecular mass of around 6 kDa. It contains three disulfide bridges (Cys6-Cys20, Cys14-Cys31, Cys33-Cys42).
Sources: en.wikipedia.org
No. Melanotan-2 is manufactured synthetically. The naturally occurring peptide in the same family is alpha-melanocyte-stimulating hormone, which the body produces as part of normal endocrine and neural signalling.
Both are synthetic analogues derived from the same parent hormone. Reference descriptions usually characterise afamelanotide as more selective for the MC1R subtype, whereas melanotan-2 is reported to interact with a wider range of melanocortin receptors.
Early studies explored melanocortin signalling and pigmentation, which later led to informal use of the label tanning peptide. That label is not a regulatory category and does not imply approved status for any purpose.
Dry powder is usually held frozen, shielded from light, and kept away from moisture. Desiccant packaging limits hydrolysis during storage. Solutions are typically aliquoted and frozen once, because repeated thawing shortens useful life.